PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN21571.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 317aa    MW: 36520.5 Da    PI: 7.9428
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN21571.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.21.6e-171966148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll +++  +G g+W++ a++ g++Rt+k+c++rw++yl
       KHN21571.1 19 RGPWTLEEDNLLSQYISSHGEGRWNLLAKRSGLKRTGKSCRLRWLNYL 66
                     89********************************************97 PP

2Myb_DNA-binding50.16.4e-1672115146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T++E++++++++ ++G++ W++Ia+ ++ gRt++++k++w++
       KHN21571.1  72 RGNLTPQEQLIILELHSKWGNR-WSKIAQNLP-GRTDNEIKNYWRT 115
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.1821470IPR017930Myb domain
SuperFamilySSF466891.12E-2917113IPR009057Homeodomain-like
SMARTSM007171.3E-151868IPR001005SANT/Myb domain
PfamPF002494.1E-161966IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-232073IPR009057Homeodomain-like
CDDcd001671.73E-112166No hitNo description
PROSITE profilePS5129420.53471121IPR017930Myb domain
SMARTSM007171.8E-1471119IPR001005SANT/Myb domain
PfamPF002491.1E-1472115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.0E-2374120IPR009057Homeodomain-like
CDDcd001678.97E-1176115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MSTSKSVSSS SEDDNELRRG PWTLEEDNLL SQYISSHGEG RWNLLAKRSG LKRTGKSCRL  60
RWLNYLKPDV KRGNLTPQEQ LIILELHSKW GNRWSKIAQN LPGRTDNEIK NYWRTRIQKQ  120
ARHLKIDTDS REFQELVRRF WMPRLLQKAK ESSSSAMSIQ NQATPMPFDG VSQHSTVGTI  180
PSHSHTPWQG PCMNEAGPTY MDQHEQNSDS EHNNGSCISL SESANFPKVP QHFGRTTITQ  240
YHALNNNDFG TFTYDGYNVS NNVYEMDNFK TPTTRVAEDA QYPTGDCQMV GSNWVNSDFA  300
CNMWNMDELW QFSKLQK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-26161214108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0961480.0BT096148.1 Soybean clone JCVI-FLGm-20M24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001235789.10.0MYB transcription factor MYB84
TrEMBLA0A0B2QJD60.0A0A0B2QJD6_GLYSO; Transcription factor MYB21
TrEMBLQ0PJK40.0Q0PJK4_SOYBN; MYB transcription factor MYB84
STRINGGLYMA05G35050.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16393494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25340.11e-77myb domain protein 116
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]